SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012382982.1.21334 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012382982.1.21334
Domain Number 1 Region: 4-188
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-52
Family Methylesterase CheB, C-terminal domain 0.0000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012382982.1.21334
Sequence length 327
Comment chemotaxis protein CheB [Beijerinckia indica]; AA=GCF_000019845.1; RF=representative genome; TAX=395963; STAX=533; NAME=Beijerinckia indica subsp. indica ATCC 9039; strain=ATCC 9039; AL=Complete Genome; RT=Major
Sequence
MSQRDIIAIGGSLGAVEAVKNLFRDLPPGIDATILIVIHVGTVGNNYLADIFDEEASIPV
TMARDGEKLKRGHAYVAPADHHLLVMGNHIRLGRGPRENMARPAIDPLFRSIAVSHGSRT
VAVVLTGLLNDGAAGLADVKRCGGVTVVQNPREATAPQMPLEALKTGYVDYIIPLEELGN
LLKKLTKEEAGQSNEIPEGLLFEVEIALGYKTGIKKNAKIADVVPLSCPACGGVLSQLKI
GLPLRFRCQTGHAYTAETLINVKEGAVDEALRVALRMIEERVFLCEKMAEDARRSDRHAA
AKIAEERMQEYKDYADLLRRTLLGKNY
Download sequence
Identical sequences B2ILH1
gi|182676966|ref|YP_001831113.1| gi|182676966|ref|YP_001831113.1|NC_010580 395963.Bind_3836 WP_012382982.1.21334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]