SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012407511.1.44837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012407511.1.44837
Domain Number 1 Region: 7-215
Classification Level Classification E-value
Superfamily ARM repeat 2.93e-28
Family PBS lyase HEAT-like repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012407511.1.44837
Sequence length 220
Comment phycocyanobilin lyase [Nostoc punctiforme]; AA=GCF_000020025.1; RF=representative genome; TAX=63737; STAX=272131; NAME=Nostoc punctiforme PCC 73102; strain=ATCC 29133; PCC 73102; AL=Complete Genome; RT=Major
Sequence
MEIDQIQTELKNPDFHSRLKAIAALNDYESEVAVPLLASKLHDSEFLVRSFVTRGLGNQQ
SAESFAALMQIMKFDDTPNVRAEAANSLSLFGRVAVSHLVMAFYQDDHWLVKRSILAAIA
EMNCPEELFDICVQGLKDEDFTVQESSVDGLSLLADSSQHTAALSQILTLVNDESWRMRV
RVSYALKRFDEPEAKAALNQLRQDEDHRVVGAALEDLLPQ
Download sequence
Identical sequences B2J9I7
WP_012407511.1.44837 63737.Npun_R0734 gi|186681233|ref|YP_001864429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]