SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012408237.1.44837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012408237.1.44837
Domain Number 1 Region: 76-281
Classification Level Classification E-value
Superfamily ARM repeat 1.3e-33
Family PBS lyase HEAT-like repeat 0.041
Further Details:      
 
Domain Number 2 Region: 283-415
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000619
Family PBS lyase HEAT-like repeat 0.0065
Further Details:      
 
Weak hits

Sequence:  WP_012408237.1.44837
Domain Number - Region: 17-106
Classification Level Classification E-value
Superfamily ARM repeat 0.00345
Family Armadillo repeat 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012408237.1.44837
Sequence length 432
Comment PBS lyase [Nostoc punctiforme]; AA=GCF_000020025.1; RF=representative genome; TAX=63737; STAX=272131; NAME=Nostoc punctiforme PCC 73102; strain=ATCC 29133; PCC 73102; AL=Complete Genome; RT=Major
Sequence
MVSNINQLLVQAQTAYNAADWSSLIQYLQQLVLGSDSQHPEVVKNREYLLTLAISVLEMG
DFQQRWEITKVLTHLGNIAIPPLIDILEDEDAEEELRWYAARTLGEFQQPEAIAPLVELL
KTDEDEELKAIAATALGQMGTVAIAALSELLKQEDTRLLAVRSLSCIPQTETITPLLSVV
QDSQATIRTAAIEALSSFHDERIPTVLLNALNDIAATVRRAAALGLGFRPDLREALDLVT
RLQPKLYDFNLDVCCAAAVSLSRMGCNDAAKHLFDLLISPQTSTKLQLKTIRALSWVGTP
SSLEYLQTAFNQITSETLWQEIATVLGRVQKPQTTQAVEILLQILRLQHPATEIVNIKSA
IALSLGQLGEIQAIEPLISLLADSNASVRLHAIAALKNLDSEVAHQKLQQLANNTALTPD
LQQGIAIALAEW
Download sequence
Identical sequences B2J0K2
63737.Npun_F1530 gi|186681966|ref|YP_001865162.1| WP_012408237.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]