SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012408944.1.42896 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012408944.1.42896
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000178
Family 7-Fe ferredoxin 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012408944.1.42896
Sequence length 75
Comment MULTISPECIES: 4Fe-4S ferredoxin [Nostocales]; AA=GCF_000316575.1; RF=na; TAX=99598; STAX=99598; NAME=Calothrix sp. PCC 7507; strain=PCC 7507; AL=Complete Genome; RT=Major
Sequence
MALINQRIDVPVIVDESKCLEKCTACIEVCPLDVLAKNPETGKAYMKYDECWFCLPCEKE
CPTNAITVQIPFLLR
Download sequence
Identical sequences A0A1Z4GEV4 A0A1Z4I811 A0A235I1I9 A0A2H6LGU2 B2J8H3 K9PPH4
WP_012408944.1.17848 WP_012408944.1.42896 WP_012408944.1.44837 63737.Npun_R2383 gi|186682697|ref|YP_001865893.1| gi|427720165|ref|YP_007068159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]