SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012409439.1.44837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012409439.1.44837
Domain Number 1 Region: 17-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-55
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 413-525
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.7e-29
Family Pentapeptide repeats 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012409439.1.44837
Sequence length 534
Comment serine/threonine protein kinase [Nostoc punctiforme]; AA=GCF_000020025.1; RF=representative genome; TAX=63737; STAX=272131; NAME=Nostoc punctiforme PCC 73102; strain=ATCC 29133; PCC 73102; AL=Complete Genome; RT=Major
Sequence
MSYCLNPICPNPENLVNSQSCQSCGSQLLLRDRYQAIKPLGQGGFGATFLANDRGLPGEP
SCVIKQLRPSGSAPHVLQMARELFEREAKTLGKIGNHPQVPRLLDYFEDHEQFYLVQEYI
SGDTLQEEVKLNGILTETGVKQFLSEILPLLQYIHEQKVIHRDIKPANLIRRTQDARMVL
IDFGAVKNQVTQGAISQSGQTALTAYAIGTPGFAPPEQMAMRPVYASDIYALGVTCIYLL
TSKTPKDLDYNPNTGEMIWEQLVQVSDHLSNVLRKMLDVSVRNRYQSAAEVLRALEIEPY
LESLAKGLLIKSDTGSKERTHNHLENSAVLCNNSSVAVTSAGVAQVAAAIRARRAKAAEA
AGSHHASGMGKSTTLANSNSNGSQVQNSKVERKLDTQGLLTAYQKGRRDFALHNLSLLNL
QGADLSGTNFHSTQLQKTNLQGANLHNSDFGRASLSKANLKDANLTKAYFNHADLEGADL
RGADLSNAYLSNANLRGANLCGANLTSAKISDEQLALAKTNWMTIRPNGKRGLL
Download sequence
Identical sequences B2IWJ4
WP_012409439.1.44837 63737.Npun_R2916 gi|186683195|ref|YP_001866391.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]