SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012409732.1.44837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012409732.1.44837
Domain Number 1 Region: 167-327
Classification Level Classification E-value
Superfamily ARM repeat 2.43e-18
Family PBS lyase HEAT-like repeat 0.086
Further Details:      
 
Domain Number 2 Region: 370-406
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000188
Family Pectin methylesterase 0.034
Further Details:      
 
Weak hits

Sequence:  WP_012409732.1.44837
Domain Number - Region: 67-97
Classification Level Classification E-value
Superfamily TPR-like 0.000818
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012409732.1.44837
Sequence length 406
Comment hypothetical protein [Nostoc punctiforme]; AA=GCF_000020025.1; RF=representative genome; TAX=63737; STAX=272131; NAME=Nostoc punctiforme PCC 73102; strain=ATCC 29133; PCC 73102; AL=Complete Genome; RT=Major
Sequence
MIAAIRQKIRSAYADNPHLALCHWFHEFDNYVDSDNFAVCEGLLSEICKEAYPPLAAKEQ
AYVDSREGVLWLKKGIEHHKQSRFEEAQNYYQKSLKIQQRVQCRDAQTNVKVFQSVLAED
CLNGTPSYLKLDSFAQELHVLGGSESLLCDRLSTSTTPEERSQILFAAVQARLTKPLVQA
FRSPDEQTRMMGIAGLGRFKQINETQVLLEGLYDSNWFVRWRAAEALAHQIVICSACNSE
NPIGIKSCQACPADINLPEVTTDLFIQKLCAVLDRETSPDVRRVLVMLLGQTNNTGVTLT
LLAALDDSDADVRIAVIEALGKIGVPSGTIEKLRNVSDGKSLLGGSIKETLEKIIGTIAD
QSLRSETAIATYIVSQDGDGDYGTISKAIASVPPGSRILVQPGLYN
Download sequence
Identical sequences B2IZY3
63737.Npun_F3316 gi|186683501|ref|YP_001866697.1| WP_012409732.1.44837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]