SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012411794.1.44837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012411794.1.44837
Domain Number - Region: 192-227
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000137
Family Rho termination factor, N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012411794.1.44837
Sequence length 228
Comment hypothetical protein [Nostoc punctiforme]; AA=GCF_000020025.1; RF=representative genome; TAX=63737; STAX=272131; NAME=Nostoc punctiforme PCC 73102; strain=ATCC 29133; PCC 73102; AL=Complete Genome; RT=Major
Sequence
MSSLSNIGNLMHLYLDEIDPGEGTNAPEFLIKASAHLLNQKEGRNWIPVIVKETGKDKYQ
VIANSFIYAIAEAARLDRVWCIITDGSDETVEVTKVLAKEEIPKINLSKASRDEIMAALE
YLVEQPGSVLKAVKPAIATNRIDEAPREYWKTLDPILNLKCGITKGKKLDALNKVFYLTP
QPMPDTITDTAILQTMTIADLKAIAKKRGITGITKMKKDNLVKALSKP
Download sequence
Identical sequences B2J6S4
63737.Npun_F5545 WP_012411794.1.44837 gi|186685597|ref|YP_001868793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]