SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012412944.1.44837 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012412944.1.44837
Domain Number 1 Region: 10-279
Classification Level Classification E-value
Superfamily Origin of replication-binding domain, RBD-like 8.7e-83
Family Relaxase domain 0.00000262
Further Details:      
 
Domain Number 2 Region: 397-822
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.26e-21
Family Tandem AAA-ATPase domain 0.028
Further Details:      
 
Domain Number 3 Region: 1499-1811,1891-2002
Classification Level Classification E-value
Superfamily ARM repeat 0.0000671
Family PHAT domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012412944.1.44837
Sequence length 2142
Comment conjugative relaxase [Nostoc punctiforme]; AA=GCF_000020025.1; RF=representative genome; TAX=63737; STAX=272131; NAME=Nostoc punctiforme PCC 73102; strain=ATCC 29133; PCC 73102; AL=Complete Genome; RT=Major
Sequence
MLTAANVSSEMAVNYFVKNYYHQGKSLWSGQGALKLGLSGAIDDEEAFKNVISGRSPQGR
EQLNARALKPDERRAALDCTFSAPKSVSLMALVGGDTRLIDAHHQALKETLELIEQRYAY
TRVTDNSGRHRVKTGNLVVAQFDHIESRDLDPHLHTHCLLMNMTQTPDGRWLSLGNNEIF
ANKKFLGMAYQSSLAREVQKLGYEIEKSKHGQFDIKGFKFEDLEAFSKRRQQIIASFSAN
STWAEREKIWDNTRQRKQKLPESELLAFWKEEAAALGIRFVKAGEPRQEIPANEKSLAEV
LDLAIAHCSERNVAFRQEDLEKFILEERLATDIAATAALIREHQELIALPGLTDQFTTMT
AVRRELATIDLMQQGQYKFCSISQREVVESHLENTLLNTGQRQAVELAATTSDQFIAWQG
VAGAGKTFALKELKAIAFNAGYTIKGFAPSSSAAKVLSEELEIQSETIARLLVTEPKEIE
PNQIWVVDEAGLLSAKDAHALLQRATLLQARVILVGDTRQLSAVEAGNPFKSLQQAGIKT
AHLNESLRQKNPQLKLAVNLIADGRIEAGFERLEANGSILQVDSFSKIEQIANDYIVGTP
EQRLKTLVLAGTNTERLALTQAIRDKLKGEGTLGETATITQLQTKNLTKVQMRFAHNFEI
GDVIMPTRDYKRRGLSKGKLYEVVGRTTDKLTLRSDDGQHLEVDTAFDKAVYQRHQIEIA
VGDRLQWKKNDRQLGRRNGQEFTVTGIDLNIVHIKYADERTERISLAQTQNLDYALVSTT
YSSQGKTADQVLISADFTIGQESFYVAASRARHELKIYTEDPTRLVELAQQSKAKDNALE
LLRKQIQKSTIEQHQAITINISAPFEKPVLKQETTVSTPNVQPIVKSVASSRTTSHDSSI
KVPKVLPVLKEIPNYNTVESVFSKPVLKSAAPTEAFWTPHQSKDIPNFLEPKHWQEFEDS
AIHPDIAAKNFESLQFNYAGGEHESWERLMVSEKLNRTNTGRLTEGLIRTYSHLDAGGWW
CDAGVDPRTFADLTPGDKPTLKRWGCYKPNQPRPKKDENNQIIEGKFIKYEHPPKVELSI
FLLNVPDDIAERIYSKHKANPSDSDRQSGFWYCVWKHNIPCAIAEGAKKAASLLSQGHAA
IGLPGISAGYRTPKDEFGKKIGKSYLHEELAIFATPSREIKFCFDYETKPKTKLNIERDI
SVTGRLLQKLGARVKVVSLPGPSKGVDDFIVASGPLAYEKLSHEAMKLRDWQQHNQHSKV
AAIEPPKLQLKESSLQQTSPNQPIGQTHDNQQQPNPDTVINREDRGIINLSRETEQEFRA
VRNQELSTHRKNSELRGSPATEVERLLTAVSRDIECQEVLELRAISTRINPSSTDDWLRG
QRATNFSRQVNPEDSAIIDGAASDVSFEQNGNAKRPTTEQLLNAITENIQQSIVDDALVE
TLPQLTEQLYGYQQHLRRARTRLDDFGAVIASIEQQISSKRTVDVISDFIEQSVVESTLI
TLLPQLVEQLSQVSQQLAHKTAIAQQSELSSSQKTVWAIAENIEYLAVSSALTEALPLLI
KQLSPLRQQQKGVRSRFDDLEAVITQIEQRLSSQRAIDAITQNVEYSAVSSALTGTLPQL
IKQFSPLRQQLKKGIATFDKIFTAIEPLSQRLDLQKTIDIIAEDIEQLAVESALSETLPQ
LIEQLSQHHQHISGRITKFDDLETAISQSEQHLSTKKTVLSVLENIEQSLVESALAETLP
RLIEQLSKTCQQQKALKPAFDKISTRIEHEIQYLSSQRTVDAIAQNIEQSLVESIITETL
PQLIEQLSKTCQQHKGRTTFEGLGVAITQIEQRLDSQKTVDPIIENIEYSAVESALIETL
PQLIEQLSQYHQQLKGGKTRFHGLEAAITQIEQRLDSQRTILSIAQSIEQSLVESIITET
LPQLIKQLSQFSQQLKVGKTTFNQFQQLLDNEFVGYLTQKTRTSEHLALNAISDYVAQET
VASYETVSALSKLKELLGVSQSQTYTEFTTALQKILDLTEKWGHHQNHSQGNVQSLSIEV
ETELLKESVKSHIKQIIHGLDIERLAALVMEVGKYVKGEKVTGAKVSELFTSVTTDAKAL
TFEQKMNIVRQLIKDDKPSIMKRLGINSPSPNDNEEHLRFRR
Download sequence
Identical sequences B2JAG8
WP_012412944.1.44837 gi|186686770|ref|YP_001869963.1|NC_010631 gi|186686770|ref|YP_001869963.1| 63737.Npun_AF036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]