SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012493976.1.13849 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012493976.1.13849
Domain Number 1 Region: 27-249
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-73
Family Atu2684-like 0.0000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012493976.1.13849
Sequence length 251
Comment DUF1223 domain-containing protein [Rhodopseudomonas palustris]; AA=GCF_000020445.1; RF=na; TAX=395960; STAX=1076; NAME=Rhodopseudomonas palustris TIE-1; strain=TIE-1; AL=Complete Genome; RT=Major
Sequence
MNGVGGFSRWSGALGLCVTIATADLAAAEPRAVVELFTSQGCSSCPPADRIIGELARDPS
VIALSLPIDYWDYLGWKDTLADSRFTARQKAYSQVRGDRDVFTPQVVVNGSAHLVGSNRA
GIDSAIKTTDKTGGVMTVPVSVAVEGKEIKVSVAAAPQGETAKSGEVWICAVSKAIPIEI
GRGENRGRHVTYHNVVRNLLKVGDWTGAAEHWTVPLENVVGDGVDAAAVYVQNGSREKPG
AMLGAAFTSLN
Download sequence
Identical sequences B3Q770
gi|192288629|ref|YP_001989234.1| 395960.Rpal_0198 WP_012493976.1.13849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]