SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012498828.1.43748 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012498828.1.43748
Domain Number 1 Region: 42-149
Classification Level Classification E-value
Superfamily Phage tail protein-like 0.0000000000000915
Family STM4215-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012498828.1.43748
Sequence length 172
Comment hypothetical protein [Chloroherpeton thalassium]; AA=GCF_000020525.1; RF=representative genome; TAX=517418; STAX=100716; NAME=Chloroherpeton thalassium ATCC 35110; strain=ATCC 35110; AL=Complete Genome; RT=Major
Sequence
MTSFEQILIAIQADILTRLGERLQPLPLALKRTADEVLLENETWTDADGLVIVRYAGSTY
GQVTAPGLTLQERELLFDVSVLCQNLTGENPEDLALGYVGQVITALAGFVPTDCTDALRV
VRDEFAQADAAAHKFHYRIRFACPALLIQTYDTEELHLLKTTDIQDLTIAST
Download sequence
Identical sequences B3QTJ8
gi|193213992|ref|YP_001995191.1| WP_012498828.1.43748 517418.Ctha_0273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]