SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012513386.1.45798 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012513386.1.45798
Domain Number 1 Region: 104-462
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 7.59e-52
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0008
Further Details:      
 
Domain Number 2 Region: 7-97
Classification Level Classification E-value
Superfamily Cytochrome c 4.73e-18
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.023
Further Details:      
 
Domain Number 3 Region: 464-550
Classification Level Classification E-value
Superfamily Cytochrome c 0.00000000458
Family monodomain cytochrome c 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012513386.1.45798
Sequence length 557
Comment cytochrome d1 heme region [Hydrogenobaculum sp. Y04AAS1]; AA=GCF_000020785.1; RF=na; TAX=380749; STAX=380749; NAME=Hydrogenobaculum sp. Y04AAS1; strain=Y04AAS1; AL=Complete Genome; RT=Major
Sequence
MRIRLIFLSLLLCCPLLSSFSSPASLGGDLYKDKCAKCHGINRMGLSGPPLIPEFLKSKS
DNTLFKIIKNGIPPTLMPSFKDLTDKQIESLIAFVKTPVTVNTWSLSDIRKTWYKLSAQN
PKPWHRTIVNFMALVEAGKNRVWFLNKAHVINKINFGDIHGGLKFSNDGKFIYIPSRTGY
IGRYNIRKGYLDYKVRACLYQRNVSLFSNGVISACWLPSQIVILNKKLEPKAVIPIDGKI
SAIYGLYNSPYAVFGLMHKSVLGFLNTSSLNLKYYDVPTAFEDFFIDPLEHFVVGTSFNH
NVLSVFDIKSKKIVYQTSFGGMPHLASAAFWYKDKNFYFATPDLKKPVITIWRAYKWKKI
KEIPSKGVGFFVKTNPNTPYLWADEHANTLLLIKKTDFKPIHVKLVKKGWIIHTQFSGDG
KYAYVSDYAKNGNVFILDSTTLKLIKSFPASYPIGKYNYVTYSNRREAALLGEEVYLQYC
WGCHHPTRTAFAPSFKYIAKHIPISLIKAQILSPDQTYKLLGFKQNVMPKFHLSKYEIDA
LLMFIEYSKNRNFWDSH
Download sequence
Identical sequences B4U7B9
WP_012513386.1.45798 gi|195952718|ref|YP_002121008.1| 380749.HY04AAS1_0340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]