SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012522265.1.63133 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012522265.1.63133
Domain Number 1 Region: 185-343
Classification Level Classification E-value
Superfamily Nucleotide cyclase 6.83e-40
Family GGDEF domain 0.00008
Further Details:      
 
Domain Number 2 Region: 97-180
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000173
Family FCH domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012522265.1.63133
Sequence length 349
Comment GGDEF domain-containing protein [Phenylobacterium zucineum]; AA=GCF_000017265.1; RF=representative genome; TAX=450851; STAX=284016; NAME=Phenylobacterium zucineum HLK1; strain=HLK1; AL=Complete Genome; RT=Major
Sequence
MSSDVETSLRGPKAYALARKAIEAMEAHQVWPTALNFELWVHYVAAKDSALATEIDHLIE
AGEPFTDAVGEQLAAQFLPKAKLNGEILEAGQTLSKELDSVSRAIESARETSEAYGQQLA
SASESLDGEDAQAIKSMVETLTVATRKVREENHALESQLQDTTAELGRLREHLEQVRRDA
MTDALSGLANRKAFDEALERACDQGEQGGPVTLAVIDIDHFKSFNDTWGHQTGDQVIRYV
ASVIQRCSPAPRVSARYGGEEFAIIFPGESARDSLAVLEAVREEVSSRILKRRSTNEDLG
AITISAGIAERKPGESPASLVERADSALYASKRGGRNRTSCADPIAAAA
Download sequence
Identical sequences B4RBS6
gi|197105175|ref|YP_002130552.1| 450851.PHZ_c1712 WP_012522265.1.63133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]