SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012526068.1.98204 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012526068.1.98204
Domain Number 1 Region: 5-218
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.56e-57
Family LplA-like 0.0000124
Further Details:      
 
Domain Number 2 Region: 227-362
Classification Level Classification E-value
Superfamily Nudix 6.91e-27
Family MutT-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012526068.1.98204
Sequence length 365
Comment MULTISPECIES: lipoyl(octanoyl) transferase [Anaeromyxobacter]; AA=GCF_000022145.1; RF=representative genome; TAX=455488; STAX=161493; NAME=Anaeromyxobacter dehalogenans 2CP-1; strain=2CP-1; AL=Complete Genome; RT=Major
Sequence
MPRVLRTYRLGRVEYEDGLALMRLAADAVRAGTPAATDFLFLLEHPPVLTLGRSAGREHI
VAAPAWLEKQGFEIHETDRGGDVTYHGPGQIVGYPVLDLNGRKDVRRYVGALEEAMIRTC
ADFGVEAGRHPEHRGCWVGRRKIGAIGVHLSRWITSHGFAFNARTDLAHFQVIVPCGIAD
PRLGVTSLEAELAARGRATPEQAEIENRLAAHLADVLELARADAGPDLRTISVVPVRPDG
RVLLLRRSVERGGFWQQVTGRIEPGEAPEQAARRELREETGADLPVVSLGYRHAFGLDPS
VNRVRPGALVVVEEVAFAARVPDGFEPRLSGEHTEHAWATGEEAAAQLRFPGLRRAVRLA
LSARR
Download sequence
Identical sequences B4UC36 B8J944
gi|197122445|ref|YP_002134396.1| WP_012526068.1.49349 WP_012526068.1.98204 gi|220917212|ref|YP_002492516.1| 447217.AnaeK_2039 455488.A2cp1_2109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]