SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012528196.1.49349 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012528196.1.49349
Domain Number 1 Region: 17-211
Classification Level Classification E-value
Superfamily Nudix 7.14e-30
Family MutT-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012528196.1.49349
Sequence length 219
Comment coenzyme A pyrophosphatase [Anaeromyxobacter sp. K]; AA=GCF_000020805.1; RF=na; TAX=447217; STAX=447217; NAME=Anaeromyxobacter sp. K; strain=K; AL=Complete Genome; RT=Major
Sequence
MRAPGFDEATERVRRALAARPRRALAVPGFRPAAVLVALLDRAGGPSILFTRRSQALEHH
RGEISFPGGRLEPGEDARAAALREAHEEVGLAPAASEVLGLLDDLPSVAGYVVTPVAASV
RAPPAAFTASAGEVDEHFELPLAQLLDPALRRASLWDPAGLPERLAAVVARAAVPFEDVD
PGTGHWRVWSFHADEARVVWGLTARILADLLDRAFAARG
Download sequence
Identical sequences B4UI30
gi|197124622|ref|YP_002136573.1| 447217.AnaeK_4241 WP_012528196.1.49349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]