SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012529591.1.31571 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012529591.1.31571
Domain Number 1 Region: 345-371
Classification Level Classification E-value
Superfamily Fibritin 0.00000314
Family Fibritin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012529591.1.31571
Sequence length 385
Comment hypothetical protein [Geobacter bemidjiensis]; AA=GCF_000020725.1; RF=representative genome; TAX=404380; STAX=225194; NAME=Geobacter bemidjiensis Bem; strain=Bem; AL=Complete Genome; RT=Major
Sequence
MRRLLFALNLSALLLALLVAPALAAPADQAERKLQGAPVSLKHAELMALRNQGGFVPGQW
YRIADFRTRWRSYITGIVHEAPVEPLLVQAITSNRLAILAYSERYPNDEIDYLIYDGSLH
GEIVNGVEIPSNDRGGIVRRKDINRGIECWFDFRAYTVRLFETAPGSGVYRDYGKGPAYV
DRPLLQVDNSSQVVIKKAGIPWRGEDGAVADNMGYGNPEHYLEAANKVQIGMNSFNIKIY
GNEVTSALFGECTDDIVCEGSWRNSQMVGFNNTVNFGGTVETSFFMGGTEVAKVSGDVTR
SVFLPGVVHATFNGRLTECMVFSGVDSKSYDGDRRGEFIGQSAEAIGAVGDAPKDGKLYV
RQNGRWVELVTAAPALRQQNAKGRQ
Download sequence
Identical sequences B5EHG8
404380.Gbem_1159 WP_012529591.1.31571 gi|197117547|ref|YP_002137974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]