SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012534449.1.44395 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012534449.1.44395
Domain Number 1 Region: 294-403,565-596,735-852
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.02e-19
Family ABC transporter ATPase domain-like 0.02
Further Details:      
 
Domain Number 2 Region: 5-99,143-261
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000112
Family PHP domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012534449.1.44395
Sequence length 890
Comment DNA repair ATPase [Aliivibrio fischeri]; AA=GCF_000020845.1; RF=na; TAX=388396; STAX=668; NAME=Vibrio fischeri MJ11; strain=MJ11; AL=Chromosome; RT=Major
Sequence
MNGSTWKKWDLHIHTPMTHLNGAGFQCAISDYVSKLAAEELDLIGVTNYFYFKENELEIV
RDEIRTQTHRITVLGNVEFRIVQQNNGGEWINVHVVFSEKLTTTQINTILSSMPITNTSP
DGRVVYCSETSMQANGVRPDQAVVDFKILNAHLSGHLQRGTDYLIGICPNGYGGFRPDVR
DGRSVAIALELEKIGDFIFGSTDRDRTFFLNSSRFPNAKERPVFKCSDSHRLEDVGSQYS
WIKARPTFEGLRQLLIEPEARVQIEDDFIERTFAKPRFKSITANGSIIAGQPLKFDDTTI
ELNPNMAAIIGGRGTGKSILLDSIRSKFRHDPLGTNQARQINTEQFSLVLDQGNGSLLSF
NDVSNSYDYLHVSQGDIQSVSQNPEQLSKEIKKMLGLTSDAFNPVTTSVVEDALAKYRAF
IGYWSTSDERGNRINTDTYQNAIIADYQGLIATLTSAENQGLIDQYQANVAQVSKLTTYL
SKSAQIQALFTQQIDPINTTINEHNQSEFSATTIPSIDYHAAIAAIEANDLLARGQIAAL
NLSNQGIVTAFQSQGITQDISSLLGKVAEYQRNIEAAHEKLREIAARTAEYHQSIQGRCQ
LSDLHKAYLENNASAITTAFNSLLTENTAWTAEQNELVKEILSDISIFGAIYFNKEKFFS
LLLSKLNGGKFRETVTQTSIQRLQAMFPINTYKDFYRLISNEEMIVLSPDKTVTLEGFCW
ETEYFNQGGRFELLDFLYLPQNIQTYLHANAEFLYKDKTVTQLSVGQRGTFYVCLKLATD
PFGSPFIFDQPEDDLDNDFIMNKLVPIFRKIKKYRQVIIVTHNANLVVNSDAEQIIIAKN
DNETLTYQSGSVEDGSVNDPSSIRGQICNILEGGGHAFWLRERKYGLNDR
Download sequence
Identical sequences B5EWD3
gi|197336515|ref|YP_002157552.1| gi|197336515|ref|YP_002157552.1|NC_011185 388396.VFMJ11_B0190 WP_012534449.1.44395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]