SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012539797.1.78452 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012539797.1.78452
Domain Number 1 Region: 137-424
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 1.31e-47
Family Variable surface antigen VlsE 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012539797.1.78452
Sequence length 428
Comment vlp protein, beta subfamily [Borrelia duttonii]; AA=GCF_000019685.1; RF=representative genome; TAX=412419; STAX=40834; NAME=Borrelia duttonii Ly; strain=Ly; AL=Complete Genome; RT=Major
Sequence
MKKPLGLLIMINLFMGCDSNSILGLGKLIDKHKDTGSNILGLGKLSDESKDALLDSALTL
GQEVLQVGKEIAPKVVNMGEEVVSGALELGQEMLQMGQNLGEVIVPGAIQAGQVILPGVL
HAGQIVVPGLLETGKVIGRGFQDIFWFVGNVVGDMLEDLLVKADIKSTDKRSKVKEHFEK
VKSQLEATKNKVDGSSGVVGNDTVIDKLITAVGKLANAVGDDKIDIGAISDSSTKASIVS
DRASVQSIIEGIKEIVDIAKKSGVNVSTEDAGATVTASSQTDATAALNSGKDGAQEGAGA
KLAQEVSKADPWAMIDKICNANVKDGNLDGNNSNAGELVTGFVNTPNGIGAKTNADFAAA
VALKAMSKDGKFAVKDNDSNSEDANKIKNAAAEAVNKLLDTLGLIIRRTVRMEIGKVDSK
VNKVVAKK
Download sequence
Identical sequences B5RPH4
412419.BDU_8024 gi|203288905|ref|YP_002223900.1|NC_011264 WP_012539797.1.78452 gi|203288905|ref|YP_002223900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]