SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012579979.1.97851 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012579979.1.97851
Domain Number 1 Region: 1-217
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 3.4e-63
Family CbiG N-terminal domain-like 0.0000981
Further Details:      
 
Domain Number 2 Region: 203-318
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 2.88e-28
Family CobE/GbiG C-terminal domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012579979.1.97851
Sequence length 330
Comment cobalamin biosynthesis protein CbiG [Thermosipho africanus]; AA=GCF_000021285.1; RF=representative genome; TAX=484019; STAX=2421; NAME=Thermosipho africanus TCF52B; strain=TCF52B; AL=Complete Genome; RT=Major
Sequence
MKIAILSITKNGAELSKRLFNSIKCDVYVKEDFKFNGAKVIDFLLKRFVKKIFKMYDALV
FIMATGIVVRVIADCLKDKFDDPAVVVIDEKGNFVISLLSGHVGGANELAKRLSKILDAV
PVITTASDVNGIESIDMIAKRYGFEIERREDLSKVSAAIVNKEHVDFILDSELDIDVESK
SYIDSTAQVYITNKVVFSKKPHVILRPKNLVVGIGCKKNIQIKKLLQFVESSLVFLNLSK
NSIRAIATIELKKKEDALLKLSKYLNVPLKIYSVEDIKKVESLFEGSEFVKKIIGVGSVA
RPVGYLESNMGKELFYSKKDGMVLSIYQDR
Download sequence
Identical sequences B7IHG5
WP_012579979.1.97851 484019.THA_1073 gi|217077154|ref|YP_002334870.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]