SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012585575.1.88725 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012585575.1.88725
Domain Number 1 Region: 15-398
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 1.31e-71
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012585575.1.88725
Sequence length 402
Comment MULTISPECIES: protein nirF [Thauera]; AA=GCF_000310185.1; RF=representative genome; TAX=1234381; STAX=164330; NAME=Thauera aminoaromatica S2; strain=S2; AL=Contig; RT=Major
Sequence
MSCREVRLAPPALWGVVLSAMVVLLSACSSVPPVAVRGTGDLGVVIERADGKVKVIETTG
RSVLATVDGLGDLSHASVVFSRDGRYAFVFGRDGGLTKVDLLARRIVGRKVQAGNAIGGS
ISHDGSLVVVQNYEPGGIKAFDANTLELVADVPATTDDGTRSKVVGLADLSGKRFIYSLF
EAGEIRITDFSDPKNPLTRRFAGGKQPYDALVTPDGRYYIAGLFGEDGLALIDLWNLDKG
SRKILSGYGRGEQPLPVFKMPHLRGWSIAGNRAYLPAIGRHEVLVVDTATWQEVDRIQVK
SQPVFAMARPDGREIWVNFAFPDNGWVQVIDTVSGKVTDTLQPGRGILHMEFLSKGHEIW
LSARDDNKVVIYDTASKQPIGGFESASPSGIFFTTRAARTGF
Download sequence
Identical sequences C4K9Y9
WP_012585575.1.58410 WP_012585575.1.88725 gi|237653278|ref|YP_002889592.1| 85643.Tmz1t_2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]