SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012593456.1.62203 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012593456.1.62203
Domain Number 1 Region: 590-688,726-740
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000000000000681
Family HD domain 0.039
Further Details:      
 
Weak hits

Sequence:  WP_012593456.1.62203
Domain Number - Region: 267-345
Classification Level Classification E-value
Superfamily Triger factor/SurA peptide-binding domain-like 0.00569
Family TF C-terminus 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012593456.1.62203
Sequence length 814
Comment MULTISPECIES: HDIG domain-containing protein [Cyanothece]; AA=GCF_000024045.1; RF=na; TAX=395962; STAX=395962; NAME=Cyanothece sp. PCC 8802; strain=PCC 8802; AL=Complete Genome; RT=Major
Sequence
MNTLQFLTEQLEKLRRSGENTRLSPLRNVDTSAKSSSATTNTSPNILQKLHCSSSLRKIH
PPLMWSLAVVSLTSVIGYRFYHQPKLAVGTVSPVTIIAPRDGIFEDIKTTEEKRKEVRTG
IIPVLQRDLELTSQLRLTLTETLAEIEGLRRMAGYFPIIAVQKIPSRTQQYLRVASEKEW
QVFRQYQGKVSSNIPNLNPNLNKAWADFQRYEQTVTKTEVNGLLAKFSESRQRYNQAKTK
IANIRSPYLTPNVMTAFLDLNQSSWEMTYKAIQNTANKILMQGLPVGMPDNLLEEIIQLH
LHSSLPASNEVIATKLLLSVLQGQHNLSIDKEETKQRAEQAAQAVEPVIVEIKRHDVIVK
AGQVITQKEFVLLDSFGLSRREINWLGLGVTVILVGGGVSIFCLINRRIHRPMRRRDHLL
LCLLSLSTPILAIFNLGYTNLPAIGLLTSSFYGPTLAVTQVLLLSGLSTFTSGTVNWSYI
LAGTAGGLLSACLAGKLRSRDELARLGGGVGIIQGAFYFAVYLSLTPVAGTIWSAVLPGA
IVYGLSGFLWSVMALGISPYLERLFDLVTPIRLVELANPNCPLLKRLSTETPGTFQHTLF
VACLAEAAARELHCNVELIRAGTLYHDIGKMHDPLGFIENQMGAPNKHDQINDPWKSVEI
IKKHVTEGLVMARKYGLPRVIRDFIPEHQGTLLISYFYYQAKQQAEKEGTAPISEEDFRY
AGPIPQSRETGIVMLADGCEAALRSLKEATPEAALGMINKIFKARWRDNQLTDCGIKYEE
LPIIADVFVKVWQQFHHQRIVYPKAALDTQATTK
Download sequence
Identical sequences B7K0M5
395962.Cyan8802_0071 41431.PCC8801_0073 gi|257057989|ref|YP_003135877.1| WP_012593456.1.62203 WP_012593456.1.93053 gi|218244964|ref|YP_002370335.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]