SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012595626.1.93053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012595626.1.93053
Domain Number 1 Region: 9-317
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.68e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00013
Further Details:      
 
Domain Number 2 Region: 363-456
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.77e-21
Family Thioltransferase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012595626.1.93053
Sequence length 461
Comment MULTISPECIES: thioredoxin-disulfide reductase [Cyanothece]; AA=GCF_000021805.1; RF=na; TAX=41431; STAX=41431; NAME=Cyanothece sp. PCC 8801; strain=PCC 8801; AL=Complete Genome; RT=Major
Sequence
MVSSTVENLVIIGSGPAGYTAAIYAGRAKLKPFLFEGLKAGGIRGGQLMTTTEVENFPGF
PEGITGPDLMDRMRAQAERWGAQCYTEDVVEVDLRQRPFKIRSTEQEVYAHSLIIATGAT
ARRLGIASEQEFWSRGISACAICDGATPLFKDEELAIVGGGDTACEEALYLTKYGSHIHV
LVRREEMRAGKIMQNRVLDHPNITVHWNTEILDGIAKGGKLVGLTTRNTQTGETGELAVK
GLFYAIGHTPNTELFKGQIELDEEGYILVKPGTVETNVEGVFAAGDVQDSNYRQAVTAAG
TGCMAALVAERWLSHNNLIQEDQQTPEKEEYEYKDESGTGLVADTEETFDISKTRHVGGY
ALRKLFHESDRLILVKYVSPVCGPCHTLKPILNKVVEEYDGRIHYVEIDIEADPEIAKNA
MVTGTPTVQFFKDKEIVEQLLGVKQKSQYRQVIDKYVPATV
Download sequence
Identical sequences B7K2G5
WP_012595626.1.62203 WP_012595626.1.93053 gi|218247143|ref|YP_002372514.1| gi|257060214|ref|YP_003138102.1| 395962.Cyan8802_2394 41431.PCC8801_2343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]