SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012596791.1.93053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012596791.1.93053
Domain Number 1 Region: 207-470
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.71e-69
Family Extended AAA-ATPase domain 0.0000000551
Further Details:      
 
Domain Number 2 Region: 463-660
Classification Level Classification E-value
Superfamily FtsH protease domain-like 4.84e-67
Family FtsH protease domain-like 0.0000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012596791.1.93053
Sequence length 673
Comment MULTISPECIES: cell division protein FtsH [Cyanothece]; AA=GCF_000021805.1; RF=na; TAX=41431; STAX=41431; NAME=Cyanothece sp. PCC 8801; strain=PCC 8801; AL=Complete Genome; RT=Major
Sequence
MGIKDKFQLLPIPPVGSLLLASAGVVVLASMLWPRSPKIPLKPYSQFLDQVEQDQVSCVR
VEPNRIIYQLKSPLDGLGTAEVPLTQPNTSPLEPKSTNPFYSSPNNPTETPDHQVTNRCD
LTQLDGVFSTVPLNDPELPKILRQRGILFGAVQPEGNFMMTLLAWVVPPLILVLAMQFLL
YRNEDRHSLAFSKSKAKVYVEGEEARITFNDVAGAEEAKTELVEIVEFLKNPERFSKIGA
RIPKGVLLVGPPGTGKTLLAKAVAGEAGVTFFSISASEFVELFVGTGAARVRDLFEQAKK
QAPCIIFIDELDAIGKSRSGGNSLSGSNDEREQTLNQLLTEMDGFNAGDATVIVLAATNR
PETLDPALLRPGRFDRQVLVDRPDLAGRLAILEIYVKKIQLGEGVNLKDLATQTPGFAGA
DLANLVNEAALLAARNQRDYVTQRDFKEAIERVIAGLEKKSRVLSDREKKVVAYHEVGHA
LIGAVMPGGGKVSKISIVPRGLSALGYTLKMPTEDRFLMSETEFREQIAMLLGGRAAEEI
IFGSVTNGASDDLQRATDIAERMVSTYGMSKVLGPLAYDKRQQNNFLGNGGENLRRMVSE
ETAKAIDEEVKQIVQGGYEQALAILNHNRELLEKISQNLLESEVIEGEELQELLDQVQSP
DPSLRPQLSELRG
Download sequence
Identical sequences B7K1J1
WP_012596791.1.62203 WP_012596791.1.93053 395962.Cyan8802_2543 41431.PCC8801_3570 gi|218248318|ref|YP_002373689.1| gi|257060355|ref|YP_003138243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]