SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012601988.1.41778 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012601988.1.41778
Domain Number 1 Region: 7-136
Classification Level Classification E-value
Superfamily Phage tail protein-like 9.68e-51
Family Lambda phage gpU-like 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012601988.1.41778
Sequence length 137
Comment MULTISPECIES: tail protein [Enterobacteriaceae]; AA=GCF_001256915.1; RF=na; TAX=624; STAX=624; NAME=Shigella sonnei; strain=KY 1058; AL=Scaffold; RT=Major
Sequence
MADPMNRHTQIRQVVLARLREQCGDSATFFDGLPAFVDAQELPAVAVWLSDAQYTGKMTD
DDDWQAVLHIAVFIRAQAPDSELDMWMESTIFPALNDVPALSGLIDTLIPLGFNYQRDNE
MATWAMAEITYQITYTN
Download sequence
Identical sequences B7L8P5
585055.EC55989_1702 gi|218695103|ref|YP_002402770.1| WP_012601988.1.31419 WP_012601988.1.40712 WP_012601988.1.41778 WP_012601988.1.44029 WP_012601988.1.53535 WP_012601988.1.61893 WP_012601988.1.99110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]