SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012608688.1.40753 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012608688.1.40753
Domain Number 1 Region: 177-524
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 1.03e-112
Family Nqo4-like 0.0000199
Further Details:      
 
Domain Number 2 Region: 17-182
Classification Level Classification E-value
Superfamily Nqo5-like 1.28e-30
Family Nqo5-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012608688.1.40753
Sequence length 545
Comment hydrogenase 3 large subunit [Desulfurococcus amylolyticus]; AA=GCF_000020905.1; RF=representative genome; TAX=490899; STAX=94694; NAME=Desulfurococcus amylolyticus 1221n; strain=1221n; AL=Complete Genome; RT=Major
Sequence
MHSQTLLDRYIQLAGKLGGKHLVEGDMVHLYIPRENLVKAASTLFNEYRLTHRTCVAIDE
RPLNGFFTLTHIFTDDSSRLYVLVKTYLEGDNPVAPSIVGEVPAADWCELEAMDLLGIQF
EGRRRERLVLPPYWPDGVYPLRKEFSYDQRLNLHAVSEKIEQAGETGVPVPIGPYHPALH
EPEYFELYVEGERILDVKYRGFHVHRGIEKLAESRMTYQQVNFLAERICGICGFEHSTCY
ALAVEKAAKLDVPERAQFIRSIVLEVERLHSHLLWLGVAFHTLGYDAGFMHMWRIREKVM
ELAEALTGSRKTYGINMVGGVRRDINEEKRKKTIEVLNELEKEFSKIIDVAISVPQVKKR
LTGTGVLPKEWAVKLGVEGPVARASGVDRDARRDLPYAAYKHASFKVPVYTEGDNMARAL
VRVDEVKESMSIIIQLLDAIPRGPIMLDKYEIPEGRIGVQVVEAPRGGDIHYVLTGKGKP
YRWRVRAPTYNNIPALRIMLRDQSLADAPLTIASIDPCFSCTDRIMVIRENGRVERISFN
RGVPL
Download sequence
Identical sequences B8D5G6
WP_012608688.1.1384 WP_012608688.1.40753 490899.DKAM_1021 gi|218884332|ref|YP_002428714.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]