SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012617304.1.75456 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012617304.1.75456
Domain Number 1 Region: 4-271
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.97e-49
Family ROO N-terminal domain-like 0.0000505
Further Details:      
 
Domain Number 2 Region: 245-390
Classification Level Classification E-value
Superfamily Flavoproteins 1.29e-26
Family Flavodoxin-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012617304.1.75456
Sequence length 395
Comment MBL fold hydrolase [Methanosphaerula palustris]; AA=GCF_000021965.1; RF=representative genome; TAX=521011; STAX=475088; NAME=Methanosphaerula palustris E1-9c; strain=E1-9c; AL=Complete Genome; RT=Major
Sequence
MTANEIVPGVHAVGTVDWDRRLFDELVPLPHGTSYNAYLVQGSEKVALIDASDPEMELPF
ITNLMKGGVGHIDYVVVNHAEQDHSGLLPLVLELYSDAKVVTNATCKDLLKSFLGIEDEK
IIVIKDGETLSLGDKTLEFLITPWVHWPDTMLTYLREDKILFSCDLFGAHMATSDLFMSD
AREWYTHAKRYYAEIMMPFRNSIKGYLERLKAYPIAIICPSHGPIHDRPETVLEAYADWT
SDEVKNTVVIPYISMHGSTKAMVDFLVRALTERGVGVKQFQLSLTDTGDLAMALVDAATI
VIATPTVLFGPHPKVVYAAYLANILKPKTRFVSVITSYGWGGKTVDTLVGMLNHLKVEVL
EPVTVKGYPTEETQKDLTRLADEIFKKHKESIGVL
Download sequence
Identical sequences B8GFD7
521011.Mpal_0614 WP_012617304.1.75456 gi|219851276|ref|YP_002465708.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]