SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012618346.1.75456 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012618346.1.75456
Domain Number 1 Region: 16-181
Classification Level Classification E-value
Superfamily CbiG N-terminal domain-like 1.31e-39
Family CbiG N-terminal domain-like 0.00022
Further Details:      
 
Domain Number 2 Region: 174-290
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 7.06e-26
Family CobE/GbiG C-terminal domain-like 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012618346.1.75456
Sequence length 290
Comment cobalamin biosynthesis protein CbiG [Methanosphaerula palustris]; AA=GCF_000021965.1; RF=representative genome; TAX=521011; STAX=475088; NAME=Methanosphaerula palustris E1-9c; strain=E1-9c; AL=Complete Genome; RT=Major
Sequence
MTRTVVIALPRFSGEAAMIARFLDADHRDYVAGVFAEVWGVYNRIVAVMSAGIVVRQVAP
LLKDKWQDPAVVVVSPDLRYAIPLVGGHHGANDLAKKLSKAGLLPVLTTATESLGLPSVE
GIATARQCDVVNRPSTRTVNAAILERDVPVYRIDGPAIVIAGPAVSFLVASGEYVVGIGC
RRGVTPLEVQQSVEEALSAAGIAVDDVRCYATTVQKRDEAGLIDGVFAMGGDLIFLDDQT
INAESPPSRSGADRIGLVGVAEPAALALSTKREMIMEKKVYGRVTIAIAR
Download sequence
Identical sequences B8GJI6
WP_012618346.1.75456 521011.Mpal_1720 gi|219852318|ref|YP_002466750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]