SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012618691.1.75456 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012618691.1.75456
Domain Number 1 Region: 40-310
Classification Level Classification E-value
Superfamily NHL repeat 1.36e-52
Family NHL repeat 0.000018
Further Details:      
 
Domain Number 2 Region: 468-522
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000706
Family Type I dockerin domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012618691.1.75456
Sequence length 522
Comment NHL repeat containing protein [Methanosphaerula palustris]; AA=GCF_000021965.1; RF=representative genome; TAX=521011; STAX=475088; NAME=Methanosphaerula palustris E1-9c; strain=E1-9c; AL=Complete Genome; RT=Major
Sequence
MKVFSLLCILLLLCGSVQAVTATETYLSSRLWGTPGFGINQFNSPEGIAVDGTGNVYVAD
MNNDRISFFTKASLPQMPSSIGRIGSGHGQFFYPHGVAVDSTGNVYVADTGNHQIQKFTV
NGNFNTQWGIKGSGTNQFNSPEGIAVDGAGNVYVADTGNNRIEKFTSSGDIVTSWGSYGS
EVGQFNRPTSVAVDNTGIGYIYVADTGNNRIQKFTLTGDLVATRSISNSGASQFNRPTSV
AVDTGGSVYVADTGNNRIQKFTSSGDLITSWGSYGSESGQFVSPCGITVDGEGTVYVADT
GNNRIQRFTPVQTYATLDFVPGTKTLVLGEHQSFDLTLSGIDTGLSGSEVIVSVANPSVL
DIVGASPPVWSSTPQYYDLPSSAVTIGGADLGNRVQGRMSNIPLGNLTVQGKLPGTTSLD
VTRYQLDDDSGNLVPVITMSVVITVSGTLIRSLPSSDTPPHDLDQDGLYEDVNGDGVFNF
NDVIQYFNQIDWISDNEPTVAFDFNRNGRVDFGDIVTLFNIL
Download sequence
Identical sequences B8GDM1
gi|219852663|ref|YP_002467095.1| 521011.Mpal_2074 WP_012618691.1.75456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]