SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012618824.1.75456 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012618824.1.75456
Domain Number 1 Region: 561-704
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.87e-20
Family Family 6 carbohydrate binding module, CBM6 0.0025
Further Details:      
 
Domain Number 2 Region: 66-341
Classification Level Classification E-value
Superfamily Fucose-specific lectin 0.000000000000262
Family Fucose-specific lectin 0.01
Further Details:      
 
Domain Number 3 Region: 451-546
Classification Level Classification E-value
Superfamily PKD domain 0.00000000000249
Family PKD domain 0.0026
Further Details:      
 
Domain Number 4 Region: 399-454
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000157
Family Type I dockerin domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012618824.1.75456
Sequence length 739
Comment carbohydrate-binding protein [Methanosphaerula palustris]; AA=GCF_000021965.1; RF=representative genome; TAX=521011; STAX=475088; NAME=Methanosphaerula palustris E1-9c; strain=E1-9c; AL=Complete Genome; RT=Major
Sequence
MRRPSFLSCWPPIFSPKVIVTVNRHIFLSILSAALLLVSLGIGPVSAQTWQNETVDSAGQ
VGFFTSLALDSAGNPRISYFDDTDGNLKYAWHDGLGWHNETVDSEGRVGWYTSLALDSAG
NPRISYSDWSNNDLKYAWHDDSGWHTETVDSEGYVGAYTSLALDSAGNPRISYSDLSNND
LKYAWHDDSGWHNETVDSKGTVGWYTSLALDSAGNPRISYLYEGTDDLKYAWHDGSGWHN
ETVDSEGYVGKCTSLALDGAGNPRISYFDNTNNDLKYAWHNDSGWHTETVDSAEWVGWYT
SLALDSNGNPRISYFDDTNDDLKYAYYDSAGWHTETVDSAGEVGLYTSLALDGAGNPRIS
YLDFTHGDLKYAWVGTPLSGVCIVPGGTALPADTDGDGLYDDVNGDGVFNFADVALYFNQ
MEWISDNEPVAAFDYNGNGRVDFGDVIWLFNYLDAPIVSPTPTSTVAAFTLNKTMGAAPL
AVQFTSSDQCDLLNWTIQLGKTPIETRSGMNLTYVFSTAGTYTVQLKASNSTTGVISSAE
NTVTVTGTSTITTEQPYPTQHNVPGRVEAEDYDQGGEGIGYSDTTTPNEGGVYRTDSVDI
ESLPGASGYDVGWIRAGEFLTYSVDTTEAGTFDIGFCVANPGSTKTVIVYVNGAPRTLTI
PATGSWITWQTATLTGVSMNAGRNLIKVDMDNAASFNFDYMEFVVDYIASPTTTTPTPTD
TTLTPTQSPTDTTPTPILT
Download sequence
Identical sequences B8GE04
521011.Mpal_2209 WP_012618824.1.75456 gi|219852796|ref|YP_002467228.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]