SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012635048.1.20074 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012635048.1.20074
Domain Number 1 Region: 62-284
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-52
Family RecA protein-like (ATPase-domain) 0.029
Further Details:      
 
Domain Number 2 Region: 247-261,295-449
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.21e-42
Family ATP-dependent protease Lon (La), catalytic domain 0.002
Further Details:      
 
Weak hits

Sequence:  WP_012635048.1.20074
Domain Number - Region: 6-30
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.068
Family RBP12 subunit of RNA polymerase II 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012635048.1.20074
Sequence length 451
Comment DNA repair protein RadA [Halothermothrix orenii]; AA=GCF_000020485.1; RF=representative genome; TAX=373903; STAX=31909; NAME=Halothermothrix orenii H 168; strain=H 168; DSM 9562; AL=Complete Genome; RT=Major
Sequence
MPRPKTYYICSECGYKSAKWMGRCLNCGAWNTFQELDEEAIEEKVDIKVTPSSITDIKAG
ACPRLSSGIGEFDRVLGGGVVPGSLILLGGAPGIGKSTLVLQMARHFSEKYGKVLYVSGE
ESASQLKMRAGRLGAINEDLYVLSETNFQQIYGVIQNEKYELIIIDSIQTIFDPRIESTP
GSISQVKEVTNRLLIQAKKLEVPIVLIGHVTKEGHLAGPRVLEHLVDTVLQFEGDRNYIY
RILRAVKNRFGSTNEIGVFEMMGSGMREVVNPSEIFLKGRAQGVSGSVIVPVVEGSRPLL
VEVQALVTYSSFGTPQRLTTGVDRKRVSILLAVLEKKAGINFHNQDVNINITGGLKVEEP
ALDLGIITAILSSCKDQEVAPDLAVIGEVGLAGEIRAVSQIERRLSELKKMGFKEVVIPG
GNISGLDFDPDINIVEVKNVNDLMKILFNRR
Download sequence
Identical sequences B8D095
WP_012635048.1.20074 373903.Hore_00880 gi|220930936|ref|YP_002507844.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]