SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012635959.1.20074 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012635959.1.20074
Domain Number 1 Region: 231-334
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.48e-19
Family ATP-dependent protease Lon (La), catalytic domain 0.0051
Further Details:      
 
Domain Number 2 Region: 137-223
Classification Level Classification E-value
Superfamily PDZ domain-like 8.81e-16
Family PDZ domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012635959.1.20074
Sequence length 337
Comment signal protein PDZ [Halothermothrix orenii]; AA=GCF_000020485.1; RF=representative genome; TAX=373903; STAX=31909; NAME=Halothermothrix orenii H 168; strain=H 168; DSM 9562; AL=Complete Genome; RT=Major
Sequence
MTENKGLIKSNAVKLFIAIIILFIIVNLVPTKYYVMSPGIAQELSPIITVKGGHKGVTSG
DFMLTAVASHRATLFDIIYISLKKPRGIEIESVEEQLPPGMDMDGYLEIMANLMEESKLH
AQAVAFKKLGYRVKVEGKGAEIVEVLPEGSAGNVLKKGDIIVGIDGKEVSFATDAVKLIR
KHNIGEEVKLKVLRGKEVMHFRVKTVELKNSPGKASIGVLITTRDLSYYFPKKVIFNTKN
IVGPSAGAMFTLEIYNQLIPEDITKGRRIAGTGTISLDGHIGKIDGVTQKVMAAERAGAD
LFLSPAKNYSEAKKAARRIKVVKVNNIDEAIRYLKNN
Download sequence
Identical sequences B8CWV5
373903.Hore_10180 WP_012635959.1.20074 gi|220931861|ref|YP_002508769.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]