SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012680766.1.62785 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012680766.1.62785
Domain Number 1 Region: 97-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000309
Family Clostridium neurotoxins, the second last domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012680766.1.62785
Sequence length 277
Comment hypothetical protein [Acidobacterium capsulatum]; AA=GCF_000022565.1; RF=representative genome; TAX=240015; STAX=33075; NAME=Acidobacterium capsulatum ATCC 51196; strain=ATCC 51196; AL=Complete Genome; RT=Major
Sequence
MGRQLILSGADFSAGGLSLNWRPSMLGANLAAWLKADAGVTSSAGAVSQLLGQSTNAYAL
VQTTSAEQPALTANEQNNLPGIASSSATAQVLATATAPAAVQFEYNKPFSLLLAFKRVGA
SPYNGNNSWEAIMSCMDPAAAFRGWFVGGSKPSGGTFTFALSYNGAQAYAINVHGATVLA
AGHPYIATVTYDGSGHAAGVSITLNGAAETMTTVNDTLGTNTAVSSGQRLAILGGSNAIA
GFQSIDSFLEGVVVNRVLSAQEIAYAQEYLKGRWAAY
Download sequence
Identical sequences C1F9Z0
240015.ACP_0366 WP_012680766.1.62785 gi|225872054|ref|YP_002753509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]