SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012692203.1.1337 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012692203.1.1337
Domain Number 1 Region: 4-199,300-388
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.49e-77
Family Bacterial dinuclear zinc exopeptidases 0.0000638
Further Details:      
 
Domain Number 2 Region: 187-293
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 3.79e-30
Family Bacterial exopeptidase dimerisation domain 0.0000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012692203.1.1337
Sequence length 393
Comment N-acyl-L-amino acid amidohydrolase [Deinococcus deserti]; AA=GCF_000020685.1; RF=representative genome; TAX=546414; STAX=310783; NAME=Deinococcus deserti VCD115; strain=VCD115; AL=Complete Genome; RT=Major
Sequence
MTTTQDRVSELTEQLLKWRRHLHMNPEVGFQEHKTAAFIEAELNSMPGLTVTRPTETSVL
AVLRGGQPGRTLLLRADIDALPIHEENQFEFASQTPGVMHACGHDGHTAILLGVARLLSA
HPEEVPGEIRMIFQHAEEVGPGGAEELVMQTELMNGVDVVTGLHLNSQLPAGVVAVKPGA
FMAAPDMIELTIQGRGGHGAHPEETVDPIAVGAQVVANLQHVVSRQVAAQDALVISITSF
HSGTTHNVIPDTAEMMGTVRTFDPALRQKAPQLIERVVKGICEAHGATYDLRYQFGYRPL
INTDWVAEQLREIALETVGPEHYQDAKPTMGGEDFSAYLEKAPGAYFNVGAGSEEADSHW
PHHHPRFTIDERSLETGVRMLHAAALRLTLPGA
Download sequence
Identical sequences C1CZ42
gi|226355094|ref|YP_002784834.1| 546414.Deide_02710 WP_012692203.1.1337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]