SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012694680.1.1337 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012694680.1.1337
Domain Number 1 Region: 9-55,204-431
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.77e-32
Family FolH catalytic domain-like 0.04
Further Details:      
 
Weak hits

Sequence:  WP_012694680.1.1337
Domain Number - Region: 90-224
Classification Level Classification E-value
Superfamily PA domain 0.00112
Family PA domain 0.0056
Further Details:      
 
Domain Number - Region: 501-549
Classification Level Classification E-value
Superfamily Aromatic aminoacid monoxygenases, catalytic and oligomerization domains 0.00497
Family Aromatic aminoacid monoxygenases, catalytic and oligomerization domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012694680.1.1337
Sequence length 590
Comment peptidase [Deinococcus deserti]; AA=GCF_000020685.1; RF=representative genome; TAX=546414; STAX=310783; NAME=Deinococcus deserti VCD115; strain=VCD115; AL=Complete Genome; RT=Major
Sequence
MLRAEERQLLDAVTLDRPWELITTFSTLKREHPNDVRRAAEHIERHLRELGIPVEIHQPE
LFLSLPGQASVSVGGTTFSAKPMAMSAIFPEGLTAPLVYQPSQYAANADDMFSSSLLDGE
VDVAGKIVVTEGFGMPGKIRELEHRGALGVIAINPGARAHWGICTSIWGTPDLHDLPRKP
RVAVANVNRPDGDRLIDLARAGAEAVFKTNLEEGWFVSPVPVVTIPGTEDPKSFVLLHGH
YDSWDYGVGDNAVGDATLLEVARNLWNNRAQLRRSVRIAWWPGHSTGRYAGSTWFADHFA
LELYRNCIAQINCDSPGCRWATEYKDVSVMAEATAWAGDIIRDVTGQDMQAERPVRAGDY
SFNNIGLSGFFMLLSTMPDDLRAEKDYYAVGGCGGNIAWHTEDDTLEVADRDILLKDIKI
YLLSAYRTANQTIIPFDYVQTLNEFDQTIAEYGEGIGTAVDLGRVRDAVETLRTDVRELM
RAARSLNGESLTSPQVRRVNFALITVARHLVQANYTRSPAFFHDPAEHVPPLPDLAVLQT
LQSADDYQRGFILTHATRGLNRLLAHLGDAQVAVRDALNHLELPVKGGTS
Download sequence
Identical sequences C1D2B8
gi|226357571|ref|YP_002787311.1|NC_012527 gi|226357571|ref|YP_002787311.1| WP_012694680.1.1337 546414.Deide_1p01240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]