SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012712628.1.90709 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012712628.1.90709
Domain Number 1 Region: 16-156
Classification Level Classification E-value
Superfamily PUA domain-like 1.49e-32
Family Atu2648/PH1033-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012712628.1.90709
Sequence length 163
Comment EVE domain-containing protein [Sulfolobus islandicus]; AA=GCF_000245135.1; RF=na; TAX=1132499; STAX=43080; NAME=Sulfolobus islandicus M.16.13; strain=M.16.13; AL=Contig; RT=Major
Sequence
MFSKSYILKILLHSVTYWLVPIQEDMWDIIRDKGVYGYKENLEEYIKEGDYIIIYVSKYY
AKRYGGKIVGIVKVLSNWYEDQTPIYPEETVRNKGIYVYRVKVEPVVIGECDMKKILDKI
RFIEDKGQIAKYLRNAPANLKRPIPESDAKIVEECLKESLLNI
Download sequence
Identical sequences C3MN73 C3MTD2 C3N3N3 C3NCL0 C3NFN4 C4KF30 D2PIH9 F0NFW4 F0NQR9
gi|227831681|ref|YP_002833461.1| gi|227828943|ref|YP_002830723.1| gi|385774656|ref|YP_005647225.1| 419942.YN1551_3083 426118.M164_2701 427317.M1425_2716 427318.M1627_2770 429572.LS215_2883 439386.YG5714_2896 gi|385777302|ref|YP_005649870.1| gi|284999237|ref|YP_003421005.1| gi|238621135|ref|YP_002915961.1| gi|229580638|ref|YP_002839038.1| gi|229583491|ref|YP_002841890.1| gi|229586150|ref|YP_002844652.1| WP_012712628.1.100559 WP_012712628.1.13477 WP_012712628.1.27461 WP_012712628.1.34992 WP_012712628.1.44962 WP_012712628.1.47130 WP_012712628.1.48461 WP_012712628.1.52267 WP_012712628.1.60638 WP_012712628.1.66823 WP_012712628.1.67233 WP_012712628.1.68242 WP_012712628.1.74483 WP_012712628.1.83431 WP_012712628.1.84481 WP_012712628.1.89621 WP_012712628.1.90709 WP_012712628.1.91160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]