SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012717312.1.52267 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012717312.1.52267
Domain Number 1 Region: 22-151
Classification Level Classification E-value
Superfamily Nqo5-like 1.1e-39
Family Nqo5-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012717312.1.52267
Sequence length 164
Comment NADH-quinone oxidoreductase subunit C [Sulfolobus islandicus]; AA=GCF_000022485.1; RF=na; TAX=419942; STAX=43080; NAME=Sulfolobus islandicus Y.N.15.51; strain=Y.N.15.51; AL=Complete Genome; RT=Major
Sequence
MSEALKSLINDLQTKFKCQAKIENDRRITVIVPDKKIMKDVANHLKNFGFDHVKAVTGID
YPEQEKLEVVYHISSYSNLDLAKIILALRITVTYKDPSLPSLYSIFESAWIGERETYEML
GIRFEGHPDLRRFFLDEDFEGVYPLRKSFKIKLEGIFVDKPTTE
Download sequence
Identical sequences C3NG19
419942.YN1551_1030 WP_012717312.1.52267 gi|229581660|ref|YP_002840059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]