SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012717865.1.52267 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012717865.1.52267
Domain Number - Region: 11-72
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0756
Family Calponin-homology domain, CH-domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012717865.1.52267
Sequence length 217
Comment hypothetical protein [Sulfolobus islandicus]; AA=GCF_000022485.1; RF=na; TAX=419942; STAX=43080; NAME=Sulfolobus islandicus Y.N.15.51; strain=Y.N.15.51; AL=Complete Genome; RT=Major
Sequence
MKNKVSIVLSICILLLLPIIFPDTYPFSPFNIGSQGISYFYNNFENITSSNVTILILMEN
INNVNPYLIYLLEGNTIIITGNYSNVNNFLHKLNADVIIAPIVLTNNLDYYMNNKIIIVN
ESNYTLIFPYAHPIIGGIPLVEVDNNSIIAYYHYGSGKIIIISTPYFFLNSYYKLFNNSE
YLHEITGTNKIRIVIYTQVSPLSEFKEFLQSLKSLHL
Download sequence
Identical sequences C3NK62
gi|229582828|ref|YP_002841227.1| 419942.YN1551_2327 WP_012717865.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]