SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012719141.1.48461 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012719141.1.48461
Domain Number 1 Region: 159-381
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.84e-68
Family ATP sulfurylase catalytic domain 0.0000137
Further Details:      
 
Domain Number 2 Region: 15-158
Classification Level Classification E-value
Superfamily PUA domain-like 1.69e-43
Family ATP sulfurylase N-terminal domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012719141.1.48461
Sequence length 406
Comment sulfate adenylyltransferase [Sulfolobus islandicus]; AA=GCF_000245195.1; RF=na; TAX=1132502; STAX=43080; NAME=Sulfolobus islandicus M.16.30; strain=M.16.30; AL=Contig; RT=Major
Sequence
MNLIGHGKVEIVERIRRISDFEELQKIEVKRQLAHEIVSIAYGFLSPLKGFMNYEEVDSV
VENMRLPNDVLWPIPIMFDYSQNEIVKEGDTIGITYLGKPLAVMEVKEIFKYDKVKLAEK
VYKTRDIKHPGVKRTLSYADAFLAGDVWLIREPQFTSPYSEFWLTPRMHRVIFEKKGWKK
IVAFQTRNVPHTGHEYLMKFAWFAANENQKVHEPRTGILVNVVIGEKRIGDYIDEAILLT
HEALSKYGYISKKVHLLSFTLWDMRYAGPREALFHAIIRSNLGCTHHVFGRDHAGVGNYY
SPYEAHQIFDNINEDDLLIKPIFLRENYYCPICGSIENEILCDHKDEKQEFSGSLIRSII
LDEVKPTKMVMRPEVYEVLMKAAKQYGFGSPFVTEEYLEKRQRIVG
Download sequence
Identical sequences C3N288
gi|229585885|ref|YP_002844387.1| WP_012719141.1.27461 WP_012719141.1.48461 WP_012719141.1.74483 WP_012719141.1.83431 WP_012719141.1.84481 WP_012719141.1.90709 427318.M1627_2493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]