SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012719516.1.22823 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012719516.1.22823
Domain Number 1 Region: 134-276
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-43
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.00022
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.1e-40
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012719516.1.22823
Sequence length 288
Comment MULTISPECIES: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [spotted fever group]; AA=GCF_000247625.1; RF=na; TAX=1144280; STAX=35793; NAME=Rickettsia sibirica subsp. mongolitimonae HA-91; strain=HA-91; AL=Contig; RT=Major
Sequence
MQQSTLLKPVSCYGIGVHSGKRTQLTIEPAKENTGIIFIRTDISSENNYIEASYFNVSDT
LLSTTISNDHKVQISTIEHLMAALWGCSIDNAIIKIDGPEVPIMDGSSKPFVFMIECAGK
KLQNAPKKYLKILKDIKVVHKDCELYCTPSDHMTVDLTIDFSSKAIGRQNLSFRDQESFT
KNIADARTFGFIRDVDYLKSKGLAQGASFENAIGIDEQDKILNPNGLRYEDEFVRHKLLD
LFGDLYTNGTSIVSAIKGYKTSHALNNELLHRIFSDTTSYKFVTSSEL
Download sequence
Identical sequences C3PMV2
WP_012719516.1.22823 WP_012719516.1.29537 WP_012719516.1.31136 WP_012719516.1.3339 WP_012719516.1.38731 WP_012719516.1.41615 WP_012719516.1.74071 WP_012719516.1.76853 WP_012719516.1.77680 WP_012719516.1.81845 WP_012719516.1.89241 WP_012719516.1.93503 gi|379017520|ref|YP_005293755.1| 347255.RAF_ORF0316 gi|378722374|ref|YP_005287260.1| gi|378723731|ref|YP_005288615.1| gi|229586504|ref|YP_002845005.1| gi|379018847|ref|YP_005295081.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]