SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012731714.1.74818 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012731714.1.74818
Domain Number 1 Region: 9-273
Classification Level Classification E-value
Superfamily Cgl1923-like 9.68e-76
Family Cgl1923-like 0.000000085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012731714.1.74818
Sequence length 361
Comment proteasome assembly chaperone [Corynebacterium kroppenstedtii]; AA=GCF_000023145.1; RF=representative genome; TAX=645127; STAX=161879; NAME=Corynebacterium kroppenstedtii DSM 44385; strain=DSM 44385; AL=Complete Genome; RT=Major
Sequence
MTMDNDETMYELEYPEPETQSDASNGLSLVVALQGYADAGQAIDNAGSHIKAALEHAPLA
TFNNDLLIDYRSRRPAVHIVDNELAPAEKTELSLDVVRDNAGIPFLLLSGPEPDLRWSAF
TEAVTDLSKRFKVTKAVSLYSAPMPVPHTRPLIVTQHGSYKSDPLRYPRFDGRITVPGSA
QLELEMKMAKEGIETAGFTAHVPHYIAASEYPSAVVKLLRAVEETAGVSIPLQALERESE
KVERELEEQVEESGEIAAVVHALEAQYDQETARYRERHDRGLLSSDGEVPTGDEIGAELE
KFLAQVNRDKDTQDIGTGDDGVEDIGAESWDESDSPRSDDDDDNSGDRRPHSDGGDDSDE
D
Download sequence
Identical sequences C4LJ22
645127.ckrop_1076 WP_012731714.1.74818 gi|237785665|ref|YP_002906370.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]