SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012735411.1.67233 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012735411.1.67233
Domain Number 1 Region: 78-162
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.02e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012735411.1.67233
Sequence length 189
Comment RNA-processing protein [Sulfolobus islandicus]; AA=GCF_000189555.1; RF=na; TAX=930945; STAX=43080; NAME=Sulfolobus islandicus REY15A; strain=REY15A; AL=Complete Genome; RT=Major
Sequence
MRILFTTVEDEKLEVVKKIIEKLEQFTDTKIMYDERTKTFNILPKGQNQYEALKAVSVIR
AIGLGFDEQSAFRLLSDEYILDVIDLKTLIGSNPDAIRRVKGRIIGEGGKAKRIIQEYTG
VDISIYGHYIGIIGPYDQVQIARKAIELLIDGKEHSSVYKFLDKAEKDLIIYKTSKLGRK
GINEIKSNR
Download sequence
Identical sequences C4KK82 F0NBB8
gi|385774911|ref|YP_005647479.1| WP_012735411.1.100559 WP_012735411.1.27011 WP_012735411.1.67233 WP_012735411.1.89621 WP_012735411.1.90709 WP_012735411.1.91160 WP_012735411.1.97021 426118.M164_0189 gi|238618666|ref|YP_002913491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]