SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012760308.1.14669 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012760308.1.14669
Domain Number 1 Region: 60-157
Classification Level Classification E-value
Superfamily Bactericidal permeability-increasing protein, BPI 0.0000366
Family Bactericidal permeability-increasing protein, BPI 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012760308.1.14669
Sequence length 159
Comment hypothetical protein [Rhizobium leguminosarum]; AA=GCF_000023185.1; RF=na; TAX=395491; STAX=384; NAME=Rhizobium leguminosarum bv. trifolii WSM1325; strain=WSM1325; AL=Complete Genome; RT=Major
Sequence
MRNCLGLLTAGVFLLQPCSFAKAQAPNALERAIGDVQPCRSLKTKVSSFGISVEVGVDKL
DSVKIENLQLSVNGDTAEASARGTLACKTSDEALVEGGFSATAEVRLKIDLSTCKTTDTS
IEIVKTGGRFGDVVKGLETQISGVLRQSLEKNLAKLCQK
Download sequence
Identical sequences C6B8Y2
gi|241518293|ref|YP_002978921.1| 395491.Rleg_5554 WP_012760308.1.14669 gi|241518293|ref|YP_002978921.1|NC_012853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]