SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012784386.1.73754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012784386.1.73754
Domain Number 1 Region: 386-472
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000879
Family Cadherin 0.043
Further Details:      
 
Weak hits

Sequence:  WP_012784386.1.73754
Domain Number - Region: 483-610
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0285
Family MAM domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012784386.1.73754
Sequence length 622
Comment Ig family protein [Catenulispora acidiphila]; AA=GCF_000024025.1; RF=representative genome; TAX=479433; STAX=304895; NAME=Catenulispora acidiphila DSM 44928; strain=DSM 44928; AL=Complete Genome; RT=Major
Sequence
MKNTNTRRRAAAAGAAVATMAAGFGLLAATAQTAQAWEINPASCKHAPHSHKHGVQPTET
QTLCDRINAAGHAAPTGSETLSYGGGVDGIGVNSGKNQVYLVFYGSQWGTQTAGSNGVSS
FSGDPKGAAPAAQKMFKDIGTGGETWSADLTQWCDGPNVAAGATSCPSNAAFVPYQSGGV
LAGVWYDNSAASPAKASGHALGVEAVNAAAHFGNTTAASNRNAYYVILSPTGTNPDDYEN
PSTGYCAWHDYNGDTTLTGGAVASSYGDIAFSNQPYNIDAGQTCGTNFVNSGSAGTLDGY
TMTLGHEWHEMMSDKNPAGGWTNNTGSSYNGQENSDECAWLKPGTTGGAANVTLGSDTFA
EQASWSNDTNGCAMSHQILTHNGGGAVTVTQPAAQTSTVGSAVSLQIQASDSTSGQTLSY
TATGLPQGVAINSASGLISGTPTTAGSSSVTVTVKDTTGASGSATFGWTVNSTTGGGTVI
TNGGFENGSLSGWTTSGVTAATATGPHAGGYAAELGNLNPSSTSTIAQTFTAGAGNSRLA
FWYNVTCDDTVQYDWATATLKDNTTGTTKTVLAKTCTNPTSGWKQVTAAVTAGDSYTLTL
SNHDDNYAGDPTYTLYDDVAVS
Download sequence
Identical sequences C7QHF2
WP_012784386.1.73754 479433.Caci_0136 gi|256389368|ref|YP_003110932.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]