SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012784728.1.73754 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012784728.1.73754
Domain Number 1 Region: 10-406
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 9.65e-33
Family Gtf glycosyltransferase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012784728.1.73754
Sequence length 419
Comment glycosyl transferase [Catenulispora acidiphila]; AA=GCF_000024025.1; RF=representative genome; TAX=479433; STAX=304895; NAME=Catenulispora acidiphila DSM 44928; strain=DSM 44928; AL=Complete Genome; RT=Major
Sequence
MTLFESPRLRVLFVAFSRSSLGHIVRSTTAAARFAADGHDVAVACHEEVRHIPEKAGLAW
LPIEEIGPAPAWRGMDDPEQLRAFVRTRLASPEYVSASLEDELRVIDLFRPDVVIADMRN
TAGVAASMRGVTAFTLHNLRLFQHPMHVVLPEVLVTLDQLGVEQAHARHVLGSTVLVPDI
AEIDGLSDVPRDTAALICSLTDEIRHLGPLLSPELLSVAARASESESGPGPRATENRRRL
LHVTLGGSGVGDQQIRRVVEAVAGLGLDIGVTLGAESLQDQVTALEDELAAVAGDSAVTV
TGFRHDVVERVAAADAAVVHGGHGSIIEALVCGTPLVFLPGSLEQRENARKIRELGLGVV
LAPDDDAAAVRAKVVKALSLKETPGPRRFARALVAADGAGRLVDYVTSSQAIRTAVAAP
Download sequence
Identical sequences C7PX82
WP_012784728.1.73754 479433.Caci_0481 gi|256389710|ref|YP_003111274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]