SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012796677.1.62203 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012796677.1.62203
Domain Number 1 Region: 12-233
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.92e-55
Family PP-loop ATPase 0.00035
Further Details:      
 
Domain Number 2 Region: 212-316
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 4.58e-24
Family MesJ substrate recognition domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012796677.1.62203
Sequence length 326
Comment tRNA lysidine(34) synthetase TilS [Cyanothece sp. PCC 8802]; AA=GCF_000024045.1; RF=na; TAX=395962; STAX=395962; NAME=Cyanothece sp. PCC 8802; strain=PCC 8802; AL=Complete Genome; RT=Major
Sequence
MWTPLHSQLHTTLRQRNLLPKGQRILIAISGGQDSVCLGKLLLDLQSKWGWKIAIGHCDH
RWSYDEGIADHVEKLAQNWGIPFYLKVANNLKETEAAARDWRYQSLIEIAQENDFTEVVT
GHTQSDRAETLLYNLIRGAGTDGLSSLTWQRNLTPNITLVRPLLNISRPETLAFCQQFDL
PIWEDAANENLKYSRNRIRQQLIPYLQTQFNPQVETNLAQTAEVLRAEVEYLETSAKMVL
EQAINEDQTQLNRLILQSVPLALQRRVMRKFLQKISQREPNFEQIEALTQLIDAPRRSRT
SSLPGNFSAEVQGDWIILSGMIKATQ
Download sequence
Identical sequences 395962.Cyan8802_0180 gi|257058096|ref|YP_003135984.1| WP_012796677.1.62203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]