SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012821988.1.78307 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012821988.1.78307
Domain Number 1 Region: 32-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000405
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012821988.1.78307
Sequence length 176
Comment MULTISPECIES: SMI1/KNR4 family protein [Pectobacterium]; AA=GCF_000260925.1; RF=na; TAX=1166016; STAX=1166016; NAME=Pectobacterium sp. SCC3193; strain=SCC3193; AL=Complete Genome; RT=Major
Sequence
MAIPKLNRILVPPDIPNESGSGNAWPYIGESTTFPNDYIEFISNYGSGIIANFIAIFNPF
TQNNDLNFFEKNKLIIDDFKYLNNEDPDYFKYNLYPEKNGLLPIGVTDNGDYIFWVVSDL
NNSDAWGTAIVASRSPDIEYFDKSITSLLSGILSRKIKANSFPNNFPPDNIIFEKF
Download sequence
Identical sequences A0A0H3I3C0 D0KDH5
WP_012821988.1.14155 WP_012821988.1.77019 WP_012821988.1.78307 gi|470152665|ref|YP_006281167.1| gi|261819512|ref|YP_003257618.1| 561231.Pecwa_0149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]