SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012842079.1.43605 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012842079.1.43605
Domain Number - Region: 124-168
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0203
Family Glycosyl hydrolases family 16 0.044
Further Details:      
 
Domain Number - Region: 32-144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.038
Family Legume lectins 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012842079.1.43605
Sequence length 179
Comment MULTISPECIES: hypothetical protein [Vibrio harveyi group]; AA=GCF_000024825.1; RF=na; TAX=150340; STAX=150340; NAME=Vibrio antiquarius; strain=EX25; AL=Complete Genome; RT=Major
Sequence
MKKAIAKIGALTAVAVSLSGCVGSNAVTGYVMGFNLKAVDNRYARGGLNMLLAPVYGVAI
AADYIVFNSLEFWTGKNPLNGKPHIFDTKMDTYIDVNHQLDKSLTTAPIAPLANNRVIEQ
GRMQQIDENTVQMDITYNNGEKAILMGVRDGEFVTYYIDGEVVAQTSMDELAAYTQNRV
Download sequence
Identical sequences gi|262395043|ref|YP_003286897.1| WP_012842079.1.36366 WP_012842079.1.43605 WP_012842079.1.82618 150340.VEA_004274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]