SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012852018.1.83154 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012852018.1.83154
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Cgl1923-like 1.14e-85
Family Cgl1923-like 0.00000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012852018.1.83154
Sequence length 304
Comment PAC2 family protein [Thermomonospora curvata]; AA=GCF_000024385.1; RF=representative genome; TAX=471852; STAX=2020; NAME=Thermomonospora curvata DSM 43183; strain=DSM 43183; AL=Complete Genome; RT=Major
Sequence
MVRNPEDLYELSGDLPEMTGPVMLYCLDGFVDAGSVGQLVREHLLNSLEHRVIARFDADS
LIDYRARRPPMTFDRDRWLDYQAPELVVHLLRDEAGTPFLFLTGPEPDRQWEAFAAAVRS
LVERLGVRLSVTFHGIPMGVPHTRPVGLTMHATRPELVNRVSFFDRVQVPGSAAALLEYR
LGQAGHDVIGYAVHVPHYLAQAAYPTAAVAALDAVIGCTGLVLPSDALREASVRTETEIA
EQVAGNDEVEKVVRALEQQYDAFTGATGRQSLLAEEAEMPTAEELGAQFERFLAQQRRAD
GSDT
Download sequence
Identical sequences D1ABJ8
WP_012852018.1.83154 471852.Tcur_1658 gi|269125902|ref|YP_003299272.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]