SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012860821.1.35130 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012860821.1.35130
Domain Number 1 Region: 72-132
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0000575
Family Occludin/ELL domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012860821.1.35130
Sequence length 209
Comment hypothetical protein [Sebaldella termitidis]; AA=GCF_000024405.1; RF=representative genome; TAX=526218; STAX=826; NAME=Sebaldella termitidis ATCC 33386; strain=ATCC 33386; AL=Complete Genome; RT=Major
Sequence
MKEFSLTYLVSILSVFISSATAVFLSIIAYKQNKKLNLQKEEHDRNLTRQKNEFDKEITR
LSGSIERMNFVHKTQFDTEFELYKKIWLEISNITKSFHNIQDHLTELNSTDNDCSEANKA
LKNEYNLLKSYSSVFSEIIDKNRPFYFQELYSLLIIFSNQSKILAEYLSNDDYQKIDLDS
YLYEMVKLLNFSVSIEEIIRNRIENLKIV
Download sequence
Identical sequences D1AHJ1
gi|269119979|ref|YP_003308156.1| WP_012860821.1.35130 526218.Sterm_1360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]