SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012863800.1.68909 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012863800.1.68909
Domain Number 1 Region: 53-114
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.000000000000017
Family TonB 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012863800.1.68909
Sequence length 115
Comment energry transducer TonB [Veillonella parvula]; AA=GCF_000024945.1; RF=representative genome; TAX=479436; STAX=29466; NAME=Veillonella parvula DSM 2008; strain=DSM 2008; AL=Complete Genome; RT=Major
Sequence
MNKVLRCIILSSLFVMSMVASVLAAPYDPPVAIATPPIDRALLSAYGEAAHGADIRFTIK
EDGSVGDVEVVSSSGSSALDAAIVDTISKWRFSPATDSNGRPVASSKTEYIDFKN
Download sequence
Identical sequences D1BQS9
479436.Vpar_0205 WP_012863800.1.68909 gi|269797272|ref|YP_003311172.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]