SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012874588.1.85100 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012874588.1.85100
Domain Number - Region: 212-365
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0144
Family Pyruvate oxidase and decarboxylase, middle domain 0.032
Further Details:      
 
Domain Number - Region: 365-436
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0147
Family Pyruvate oxidase and decarboxylase, middle domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012874588.1.85100
Sequence length 450
Comment TIGR00300 family protein [Thermobaculum terrenum]; AA=GCF_000025005.1; RF=representative genome; TAX=525904; STAX=166501; NAME=Thermobaculum terrenum ATCC BAA-798; strain=ATCC BAA-798; AL=Complete Genome; RT=Major
Sequence
MQGQNNGRSSLPFYKTIELRGHIIDSHILSQVMDLVMDYNAEFYIEQFEVGKHKYDPSYA
RLILYAPTPETLDELMEAVTKLGAQLLESEEVDARTEPAPKDGVLPEDFYSTTNMPTEVR
IDGKWFPVENIEMDVAIAIRLNEEGKPIGAYTVPMSDVRKGTPIVVGHQGIKVSPIERPR
SPALLGSPSRASQGHVFSFMSSAVSTERPKAAAIAEIAQRMREIRDSGGTTLVVGGPAIV
HTGAGPQLAALIRHGFVHLLFAGNALAAHDIESAFFNTSLGVSLDANSEGATYEHGHEHH
IRAINKIRYYGGIRQAVEAGVLKQGIMYECIVNNVPYVLAGSIRDDGPIPDVITDVIEAQ
RAMRRHIQAGVDLALLIGTTLHSIAVGNLLPANVLTVCVDINPSVVTKLLDRGSLQTAGL
VIDAGGFLRELCYQLGLREKSSIDSPTKVQ
Download sequence
Identical sequences D1CF47
525904.Tter_0636 WP_012874588.1.85100 gi|269925752|ref|YP_003322375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]